PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G206300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 293aa    MW: 32027.9 Da    PI: 7.0982
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G206300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.91.7e-4371061100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l++++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++ 
  Aqcoe5G206300.1.p   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNPTQREDAVNSLAYEAEHRLRDPVYGCVGLISILQHKLKQVQL 98 
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        el  +++e
  Aqcoe5G206300.1.p  99 ELYNARKE 106
                        *9988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1446107IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-437103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MASSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNPTQR  60
EDAVNSLAYE AEHRLRDPVY GCVGLISILQ HKLKQVQLEL YNARKELSTY IGPQAMQPLL  120
LHQAHHPQVI HPTGAMGPFG MSSMALGLPP GPSAQSQLMI RDPQQQQLYE VQQYAALAAA  180
REQQELMRGY EQQQQDLIRY NATAYDANAG GQGTGGGGGG VGGFNQMSAA MPSPLAMVPV  240
GYENAFQLQQ HQQQQQAQQD HQHQQQQQQV HSQPQPQQRT GSDEGTSVGP SS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255134.11e-109PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ32e-72LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS928e-95A0A0B0PS92_G
STRINGVIT_07s0197g00020.t013e-89(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-70ASYMMETRIC LEAVES 2-like 1